Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF9 Peptide - C-terminal region

RASSF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P-CIP1, PAMCI

UniProt

O75901

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF9 Rabbit Polyclonal Antibody (orb331356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005438

Preservative

Lyophilized powder

AA Sequence

KEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ibuprofen 2-Monoglyceride
TRC-I400140-250MG 250 mg

Ibuprofen 2-Monoglyceride

Sign In for Pricing
View Details
QuicKey Pro Human Pg (Progesterone) ELISA Kit
E-OSEL-H0011-01 24 Tests

QuicKey Pro Human Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human Pg (Progesterone) ELISA Kit
E-OSEL-H0011-02 48 Tests

QuicKey Pro Human Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human Pg (Progesterone) ELISA Kit
E-OSEL-H0011-03 96 Tests

QuicKey Pro Human Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
C16orf55 (SPATA33) Human Gene Knockout Kit (CRISPR)
KN417400 1 Kit

C16orf55 (SPATA33) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF488A conjugate, 0.1mg/mL
BNC882266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details