Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF9 Peptide - C-terminal region

RASSF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P-CIP1, PAMCI

UniProt

O75901

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF9 Rabbit Polyclonal Antibody (orb331356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005438

Preservative

Lyophilized powder

AA Sequence

KEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS708149 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human CCDC90B activation kit by CRISPRa
GA111859 1 Kit

Human CCDC90B activation kit by CRISPRa

Sign In for Pricing
View Details
MyoD1 Recombinant Rabbit monoclonal Antibody
HA750395 100 µL

MyoD1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HER4/ErbB4 Protein (His Tag)
PKSH033544-01 10 µg

Recombinant Human HER4/ErbB4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HER4/ErbB4 Protein (His Tag)
PKSH033544-02 50 µg

Recombinant Human HER4/ErbB4 Protein (His Tag)

Sign In for Pricing
View Details
MDMA Hydrochloride
TRC-M303985-10MG 10 mg

MDMA Hydrochloride

Sign In for Pricing
View Details