Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB19 Peptide - N-terminal region

RAB19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAB19B

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB19 Rabbit Polyclonal Antibody (orb586729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008749

Preservative

Lyophilized powder

AA Sequence

GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-ProANP (N-Terminal Pro Atrial Natriuretic Peptide) ELISA Kit
EH3446 96 Tests

Human NT-ProANP (N-Terminal Pro Atrial Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Sodium channel subunit beta-4 (SCN4B) Antibody
abx340804-01 20 µL

Sodium channel subunit beta-4 (SCN4B) Antibody

Sign In for Pricing
View Details
Sodium channel subunit beta-4 (SCN4B) Antibody
abx340804-02 50 µL

Sodium channel subunit beta-4 (SCN4B) Antibody

Sign In for Pricing
View Details
Sodium channel subunit beta-4 (SCN4B) Antibody
abx340804-03 100 µL

Sodium channel subunit beta-4 (SCN4B) Antibody

Sign In for Pricing
View Details
Sodium channel subunit beta-4 (SCN4B) Antibody
abx340804-04 200 µL

Sodium channel subunit beta-4 (SCN4B) Antibody

Sign In for Pricing
View Details
Sodium channel subunit beta-4 (SCN4B) Antibody
abx340804-05 1 mL

Sodium channel subunit beta-4 (SCN4B) Antibody

Sign In for Pricing
View Details