Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB19 Peptide - N-terminal region

RAB19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAB19B

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB19 Rabbit Polyclonal Antibody (orb586729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008749

Preservative

Lyophilized powder

AA Sequence

GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-875-5p miRNA Agomir
abx880656-01 5 nmol

Human hsa-miR-875-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-875-5p miRNA Agomir
abx880656-02 10 nmol

Human hsa-miR-875-5p miRNA Agomir

Sign In for Pricing
View Details
DUMP Disodium Salt
dNMP011-1K 1 Kg

DUMP Disodium Salt

Sign In for Pricing
View Details
PYCR1 (NM_001282279) Human Tagged ORF Clone
RC237220 10 µg

PYCR1 (NM_001282279) Human Tagged ORF Clone

Sign In for Pricing
View Details
(R) - (4-Nitrophenyl) oxirane
463628 50 mg

(R) - (4-Nitrophenyl) oxirane

Sign In for Pricing
View Details
Cd302 (NM_001013916) Rat Tagged Lenti ORF Clone
RR211965L3 10 µg

Cd302 (NM_001013916) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details