Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEF8 Peptide - N-terminal region

DEF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20186, MGC104349

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEF8 Rabbit Polyclonal Antibody (orb586791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060172

Preservative

Lyophilized powder

AA Sequence

PFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ehbp1 (NM_153078) Mouse Tagged ORF Clone
MG217649 10 µg

Ehbp1 (NM_153078) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DDB1 Recombinant Mouse mAb
E47M60409 100 µL

DDB1 Recombinant Mouse mAb

Sign In for Pricing
View Details
Calmodulin (bovine brain), (agarose immobilized)
MBS566564-01 1 mL

Calmodulin (bovine brain), (agarose immobilized)

Sign In for Pricing
View Details
Calmodulin (bovine brain), (agarose immobilized)
MBS566564-02 5x 1 mL

Calmodulin (bovine brain), (agarose immobilized)

Sign In for Pricing
View Details
Human CFAP119 qPCR Primer Pair
QH57957S 200 Tests

Human CFAP119 qPCR Primer Pair

Sign In for Pricing
View Details
HNRPLL (HNRNPLL) (NM_138394) Human Tagged ORF Clone Lentiviral Particle
RC203569L3V 200 µL

HNRPLL (HNRNPLL) (NM_138394) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details