Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEF8 Peptide - N-terminal region

DEF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20186, MGC104349

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEF8 Rabbit Polyclonal Antibody (orb586791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060172

Preservative

Lyophilized powder

AA Sequence

PFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIWIL1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0665R-BF555 100 µL

PIWIL1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
EKU06963-01 48 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
EKU06963-02 96 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit
EKU06963-03 5x 96 Tests

Human Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) ELISA Kit

Sign In for Pricing
View Details
Proline-serine-threonine Phosphatase-interacting protein 2 (PSTPIP2) Mouse ELISA Kit
G1860 96 Tests

Proline-serine-threonine Phosphatase-interacting protein 2 (PSTPIP2) Mouse ELISA Kit

Sign In for Pricing
View Details
Plexin A2 (Plexin-A2, PLXNA2, PLXN2, KIAA0463, OCT, Semaphorin Receptor OCT, UNQ209/PRO235)
P4271-14C 100 µL

Plexin A2 (Plexin-A2, PLXNA2, PLXN2, KIAA0463, OCT, Semaphorin Receptor OCT, UNQ209/PRO235)

Sign In for Pricing
View Details