Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR158 Peptide - C-terminal region

GPR158 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ37801, KIAA1136, RP11-59G22.1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR158 Rabbit Polyclonal Antibody (orb586813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065803

Preservative

Lyophilized powder

AA Sequence

LPPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr38 shRNA Plasmid (m)
sc-150797-SH 20 µg

Olfr38 shRNA Plasmid (m)

Sign In for Pricing
View Details
SCARF1 Antibody
R35880-100UG 100 µg

SCARF1 Antibody

Sign In for Pricing
View Details
Rhesus D antigen Antibody [D7C2], Rabbit IgG
24-654 0.2 mg

Rhesus D antigen Antibody [D7C2], Rabbit IgG

Sign In for Pricing
View Details
Polyclonal TP53 / p53 Antibody (Acetyl-Lys379)
APG03006G 0.05ml

Polyclonal TP53 / p53 Antibody (Acetyl-Lys379)

Sign In for Pricing
View Details
KCNH7 Protein Vector (Mouse) (pPM-C-HA)
PV193404 500 ng

KCNH7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
D-Raffinose pentahydrate
R-030-10G-10g 10 g

D-Raffinose pentahydrate

Sign In for Pricing
View Details