Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR158 Peptide - C-terminal region

GPR158 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ37801, KIAA1136, RP11-59G22.1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR158 Rabbit Polyclonal Antibody (orb586813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065803

Preservative

Lyophilized powder

AA Sequence

LPPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A1 Human shRNA Plasmid Kit (Locus ID 27173)
TL315675 1 Kit

SLC39A1 Human shRNA Plasmid Kit (Locus ID 27173)

Sign In for Pricing
View Details
FAM176B (EVA1B) (NM_018166) Human Over-expression Lysate
LH10594V 100 µg

FAM176B (EVA1B) (NM_018166) Human Over-expression Lysate

Sign In for Pricing
View Details
2,5-Dichlorobenzoyl Chloride
sc-487658 5 g

2,5-Dichlorobenzoyl Chloride

Sign In for Pricing
View Details
Troponin I (Cardiac) (MaxLight 750) discontinued
227218-ML750 100 µL

Troponin I (Cardiac) (MaxLight 750) discontinued

Sign In for Pricing
View Details
APOF 3'UTR Lenti-reporter-Luc Vector
12183081 1.0 µg

APOF 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
N-[ (Diethoxyphosphiny1) ]acetyl-L-aspartic acid di-tert-butyl ester
orb1908105-01 5 mg

N-[ (Diethoxyphosphiny1) ]acetyl-L-aspartic acid di-tert-butyl ester

Sign In for Pricing
View Details