Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem165 Peptide - N-terminal region

Tmem165 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AV026557, Tpardl, Tparl, pFT27

UniProt

P52875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem165 Rabbit Polyclonal Antibody (orb580693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035756

Preservative

Lyophilized powder

AA Sequence

MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GLIPR2 activation kit by CRISPRa
GA115817 1 Kit

Human GLIPR2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL
BNUB2344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL

Sign In for Pricing
View Details
SGTA Human Gene Knockout Kit (CRISPR)
KN201429BN 1 Kit

SGTA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arotinolol-D5 Hydrochloride
TRC-A771502-1MG 1 mg

Arotinolol-D5 Hydrochloride

Sign In for Pricing
View Details
PTG19-T PCR Cloning Vector, 20apps
TA010 20 applications

PTG19-T PCR Cloning Vector, 20apps

Sign In for Pricing
View Details
D-Apiose (~0.9 M in water)
TRC-A726650-25MG 25 mg

D-Apiose (~0.9 M in water)

Sign In for Pricing
View Details