Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC10 Peptide - C-terminal region

LRRC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRLRRP, LRRC10A, MGC125812

UniProt

Q5BKY1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC10 Rabbit Polyclonal Antibody (orb586624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963844

Preservative

Lyophilized powder

AA Sequence

SSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK16-set siRNA/shRNA/RNAi Lentivector (Human)
25396091 4x 500 ng

KCNK16-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Cytokeratin 5 Antibody
NBP2-92884-0.02mL 0.02 mL

Rabbit Polyclonal Cytokeratin 5 Antibody

Sign In for Pricing
View Details
ELISA kit for Rat INHBP (Inhibin Binding Protein)
E-EL-R0524 96 Tests

ELISA kit for Rat INHBP (Inhibin Binding Protein)

Sign In for Pricing
View Details
BRPF3 (NM_015695) Human Tagged Lenti ORF Clone
RC215683L1 10 µg

BRPF3 (NM_015695) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (Biotin)
128417-Biotin 100 µL

IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (Biotin)

Sign In for Pricing
View Details
FGFR3 (Phospho Tyr577) Rabbit Polyclonal Antibody
E28PP1859 100 µL

FGFR3 (Phospho Tyr577) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details