NEMF Peptide - C-terminal region
NEMF Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ10051, NY-CO-1
UniProt
O60524
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NEMF Rabbit Polyclonal Antibody (orb586861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004704
Preservative
Lyophilized powder
AA Sequence
YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BAF-012-2 2 mL
Biotin Conjugated Goat Affinity Purified Antibody to Rabbit IgG,
Sign In for Pricing
View Details 
MC21F-NA 10x 96 Well Plates
Neutravidin Coated - 96 well Solid plates - Clear PS
Sign In for Pricing
View Details 
KN210428RB 1 Kit
beta 3 Adrenergic Receptor (ADRB3) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
TRC-C988130-1MG 1 mg
alpha-Cyclohexyl-alpha-hydroxy-3-cyclohexene-1-acetic Acid 4-(Diethylamino)-2-butyn-1-yl Ester
Sign In for Pricing
View Details