Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEMF Peptide - C-terminal region

NEMF Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10051, NY-CO-1

UniProt

O60524

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEMF Rabbit Polyclonal Antibody (orb586861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004704

Preservative

Lyophilized powder

AA Sequence

YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Thymus
CB502613 1 Block

Frozen Tissue Blocks, Thymus

Sign In for Pricing
View Details
Rhodamine 800 *CAS 137993-41-0*
68-AAT 25 mg

Rhodamine 800 *CAS 137993-41-0*

Sign In for Pricing
View Details
Human lambda, AlpHcAbs® Goat
HA710293 100 µg

Human lambda, AlpHcAbs® Goat

Sign In for Pricing
View Details
CD300E Human Gene Knockout Kit (CRISPR)
KN420200 1 Kit

CD300E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAJB5 (NM_001135005) Human Over-expression Lysate
LY427522 100 µg

DNAJB5 (NM_001135005) Human Over-expression Lysate

Sign In for Pricing
View Details
PXMP4 (Center) Rabbit Polyclonal Antibody
AP53527PU-N 400 µL

PXMP4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details