Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAS1L Peptide - middle region

LAS1L Peptide - middle region

Product Specifications

Product Name Alternative

Las1-like, dJ475B7.2

UniProt

Q9Y4W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAS1L Rabbit Polyclonal Antibody (orb324567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112483

Preservative

Lyophilized powder

AA Sequence

SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RBP5 Protein
CRP2798-01 10 µg

Recombinant Human RBP5 Protein

Sign In for Pricing
View Details
Recombinant Human RBP5 Protein
CRP2798-02 50 µg

Recombinant Human RBP5 Protein

Sign In for Pricing
View Details
Recombinant Human RBP5 Protein
CRP2798-03 500 µg

Recombinant Human RBP5 Protein

Sign In for Pricing
View Details
pGreenFire1-Gal4 (plasmid)+ EF1-Neo
TR017PA-N 10 µg

pGreenFire1-Gal4 (plasmid)+ EF1-Neo

Sign In for Pricing
View Details
2310037I24Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10396064 1.0 µg DNA

2310037I24Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Arpp21 shRNA (UAS) - Lentiviral mouse Arpp21 shRNA (UAS, iRFP) plasmid
GTR15181708 1 Vial

Lentiviral mouse Arpp21 shRNA (UAS) - Lentiviral mouse Arpp21 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details