LAS1L Peptide - middle region
LAS1L Peptide - middle region
Product Specifications
Product Name Alternative
Las1-like, dJ475B7.2
UniProt
Q9Y4W2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAS1L Rabbit Polyclonal Antibody (orb324567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112483
Preservative
Lyophilized powder
AA Sequence
SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV667646 1.0 µg DNA
HARBI1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
298163-01 20 µL
Cyclic AMP (cAMP, Cyclic Adenosine Monophosphate) (Not for Export EU)
Sign In for Pricing
View Details 298163-02 100 µL
Cyclic AMP (cAMP, Cyclic Adenosine Monophosphate) (Not for Export EU)
Sign In for Pricing
View Details