Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmx2 Peptide - C-terminal region

Tmx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2310042M24Rik, AA589631, Txndc14

UniProt

Q9D710

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmx2 Rabbit Polyclonal Antibody (orb579983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080144

Preservative

Lyophilized powder

AA Sequence

IRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH3A Peptide
42-381P 0.1 mg

IDH3A Peptide

Sign In for Pricing
View Details
Human DEXI (Dexamethasone-induced protein) Quick ELISA Kit
orb2568217-01 48 Tests

Human DEXI (Dexamethasone-induced protein) Quick ELISA Kit

Sign In for Pricing
View Details
Human DEXI (Dexamethasone-induced protein) Quick ELISA Kit
orb2568217-02 96 Tests

Human DEXI (Dexamethasone-induced protein) Quick ELISA Kit

Sign In for Pricing
View Details
ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)
KTE70484-01 48 Tests

ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)

Sign In for Pricing
View Details
ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)
KTE70484-02 96 Tests

ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)

Sign In for Pricing
View Details
ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)
KTE70484-03 5x 96 Well

ELISA kit for Mouse Sphingosine 1-phosphate receptor 2 (S1PR2)

Sign In for Pricing
View Details