Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L2 Peptide - middle region

TPD52L2 Peptide - middle region

Product Specifications

Product Name Alternative

D54

UniProt

O43399

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPD52L2 Rabbit Polyclonal Antibody (orb331173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003279

Preservative

Lyophilized powder

AA Sequence

QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOX1 (NM_007052) Human Over-expression Lysate
LY402083 100 µg

NOX1 (NM_007052) Human Over-expression Lysate

Sign In for Pricing
View Details
EMD Antibody
KC-25919-01 50 μL

EMD Antibody

Sign In for Pricing
View Details
EMD Antibody
KC-25919-02 100 µL

EMD Antibody

Sign In for Pricing
View Details
EMD Antibody
KC-25919-03 1 mL

EMD Antibody

Sign In for Pricing
View Details
Bromothymol Blue
TRC-B699310-2.5G 2.5 g

Bromothymol Blue

Sign In for Pricing
View Details
PML Protein (PML) Mouse Monoclonal Antibody [Clone ID: B3E9]
AM09254PU-N 500 µg

PML Protein (PML) Mouse Monoclonal Antibody [Clone ID: B3E9]

Sign In for Pricing
View Details