Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L2 Peptide - middle region

TPD52L2 Peptide - middle region

Product Specifications

Product Name Alternative

D54

UniProt

O43399

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPD52L2 Rabbit Polyclonal Antibody (orb331173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003279

Preservative

Lyophilized powder

AA Sequence

QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4''-Keto-5-O-[(2-propenyloxy)carbonyl]-Abamectin
TRC-K816820-500MG 500 mg

4''-Keto-5-O-[(2-propenyloxy)carbonyl]-Abamectin

Sign In for Pricing
View Details
Uncoated Human CD48 (CD48 antigen) ELISA Kit
E-UNEL-H0401-01 5x 96 Tests

Uncoated Human CD48 (CD48 antigen) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CD48 (CD48 antigen) ELISA Kit
E-UNEL-H0401-02 15x 96 Tests

Uncoated Human CD48 (CD48 antigen) ELISA Kit

Sign In for Pricing
View Details
Human PDILT activation kit by CRISPRa
GA116456 1 Kit

Human PDILT activation kit by CRISPRa

Sign In for Pricing
View Details
5-Cholenic Acid-3b-ol
TRC-C431010-250MG 250 mg

5-Cholenic Acid-3b-ol

Sign In for Pricing
View Details
KCNQ4 Polyclonal Antibody
E-AB-16544-01 20 µL

KCNQ4 Polyclonal Antibody

Sign In for Pricing
View Details