PLA2G2C Peptide - middle region
PLA2G2C Peptide - middle region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLA2G2C Rabbit Polyclonal Antibody (orb586720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099042
Preservative
Lyophilized powder
AA Sequence
LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126789-ML405 100 µL
FGFR1OP (FGFR1 Oncogene Partner, FOP) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS6340277-01 0.2 mL
RAP2B, ID (RAP2B, Ras-related protein Rap-2b) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6340277-02 5x 0.2 mL
RAP2B, ID (RAP2B, Ras-related protein Rap-2b) (Azide free) (HRP)
Sign In for Pricing
View Details 