Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMSAP3 Peptide - C-terminal region

CAMSAP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1543, NEZHA

UniProt

Q9P1Y5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMSAP3 Rabbit Polyclonal Antibody (orb586837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065953

Preservative

Lyophilized powder

AA Sequence

APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isomebumal
TRC-I821260-1G 1 g

Isomebumal

Sign In for Pricing
View Details
2-Aminobenzylcyanide, Hydrochloride
TRC-A596925-2G 2 g

2-Aminobenzylcyanide, Hydrochloride

Sign In for Pricing
View Details
AKR1C4 Rabbit Polyclonal Antibody
TA369168 100 µL

AKR1C4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (HHV8/3606), CF640R conjugate, 0.1mg/mL
BNC403606-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (HHV8/3606), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Abhd14a Mouse Gene Knockout Kit (CRISPR)
KN500651 1 Kit

Abhd14a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZPBP1 (ZPBP) (NM_001159878) Human Over-expression Lysate
LY431864 100 µg

ZPBP1 (ZPBP) (NM_001159878) Human Over-expression Lysate

Sign In for Pricing
View Details