Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YOD1 Peptide - C-terminal region

YOD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUBA8, OTUD2, PRO0907

UniProt

Q5VVQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YOD1 Rabbit Polyclonal Antibody (orb586912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061036

Preservative

Lyophilized powder

AA Sequence

ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD24 (M1/69) In Vivo Antibody - Low Endotoxin
ICH1192-5mg 5 mg

Anti-Mouse CD24 (M1/69) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
TSC21 (TEX37) (Center) Rabbit Polyclonal Antibody
AP50604PU-N 400 µL

TSC21 (TEX37) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DGCR8 Human Gene Knockout Kit (CRISPR)
KN219451 1 Kit

DGCR8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CGGBP1 (NM_003663) Human Recombinant Protein
TP308653L 1 mg

CGGBP1 (NM_003663) Human Recombinant Protein

Sign In for Pricing
View Details
VSIG8 (C1orf204) (C-term) Rabbit Polyclonal Antibody
AP54521PU-N 400 µL

VSIG8 (C1orf204) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUFIP1 Human Gene Knockout Kit (CRISPR)
KN415727 1 Kit

NUFIP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details