Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YOD1 Peptide - C-terminal region

YOD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUBA8, OTUD2, PRO0907

UniProt

Q5VVQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YOD1 Rabbit Polyclonal Antibody (orb586912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061036

Preservative

Lyophilized powder

AA Sequence

ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328C-01 50 Tests

FITC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328C-02 100 Tests

FITC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328C-03 2x 100 Tests

FITC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
Monkey Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-Si-01 96 Tests

Monkey Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
Monkey Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-Si-02 48 Tests

Monkey Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
RAB11A (NM_004663) Human Over-expression Lysate
LY401478 100 µg

RAB11A (NM_004663) Human Over-expression Lysate

Sign In for Pricing
View Details