Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B9D1 Peptide - N-terminal region

B9D1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B9, EPPB9, MKS9, MKSR1

UniProt

Q9UPM9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B9D1 Rabbit Polyclonal Antibody (orb586929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056496

Preservative

Lyophilized powder

AA Sequence

VYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHV4-31 Protein Lysate (Human) with C-Ha Tag
24497031 100 µg

IGHV4-31 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
NCRNA00158 3'UTR Lenti-reporter-Luc Vector
62559081 1.0 µg

NCRNA00158 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Berry Flavonoid Standards Kit
orb322054 1 Kit

Berry Flavonoid Standards Kit

Sign In for Pricing
View Details
SLAI1 Rabbit Polyclonal Antibody
MBS9517007-01 0.05 mL

SLAI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLAI1 Rabbit Polyclonal Antibody
MBS9517007-02 0.1 mL

SLAI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLAI1 Rabbit Polyclonal Antibody
MBS9517007-03 5x 0.1 mL

SLAI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details