Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP85L Peptide - N-terminal region

CEP85L Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf204, NY-BR-15, bA57K17.2

UniProt

Q5SZL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP85L Rabbit Polyclonal Antibody (orb326713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035940

Preservative

Lyophilized powder

AA Sequence

KAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKYKFESCSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN15 (NM_012339) Human Over-expression Lysate
LC402201 20 µg

TSPAN15 (NM_012339) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Dnal4 activation kit by CRISPRa
GA205649 1 Kit

Mouse Dnal4 activation kit by CRISPRa

Sign In for Pricing
View Details
Transthyretin (Prealbumin) (CPTC-TTR-1), CF640R conjugate, 0.1mg/mL
BNC402249-100 1x 100 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Taf1b activation kit by CRISPRa
GA204199 1 Kit

Mouse Taf1b activation kit by CRISPRa

Sign In for Pricing
View Details
MKS1 Rabbit Polyclonal Antibody
TA370595 100 µL

MKS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein Kinase D2 (PRKD2) Human Gene Knockout Kit (CRISPR)
KN414956 1 Kit

Protein Kinase D2 (PRKD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details