Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP85L Peptide - N-terminal region

CEP85L Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf204, NY-BR-15, bA57K17.2

UniProt

Q5SZL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP85L Rabbit Polyclonal Antibody (orb326713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035940

Preservative

Lyophilized powder

AA Sequence

KAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKYKFESCSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLK4 Antibody
8C11717-AAT 50 µg

CLK4 Antibody

Sign In for Pricing
View Details
Nitrobenzene
TRC-N493000-1G 1 g

Nitrobenzene

Sign In for Pricing
View Details
EIF4G (Ab-1108) Antibody
8B0642-AAT 50 µg

EIF4G (Ab-1108) Antibody

Sign In for Pricing
View Details
GSTCD Polyclonal Antibody
E-AB-19080-01 20 µL

GSTCD Polyclonal Antibody

Sign In for Pricing
View Details
GSTCD Polyclonal Antibody
E-AB-19080-02 60 µL

GSTCD Polyclonal Antibody

Sign In for Pricing
View Details
GSTCD Polyclonal Antibody
E-AB-19080-03 120 µL

GSTCD Polyclonal Antibody

Sign In for Pricing
View Details