Ube2h Peptide - N-terminal region
Ube2h Peptide - N-terminal region
Product Specifications
Product Name Alternative
1500009C23Rik, AI181839, AI326965, AI462483, AW227540, E2-20K, N28148, Ubc8
UniProt
P62257
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ube2h Rabbit Polyclonal Antibody (orb578685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033485
Preservative
Lyophilized powder
AA Sequence
PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15154247 1 Vial
Lentiviral mouse Rnf113a1 shRNA (UAS) - Lentiviral mouse Rnf113a1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
035220-ML750 100 µL
ERP27, CT (ERP27, C12orf46, Endoplasmic reticulum resident protein 27) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
K0112305 3x 1.0 µg
ARF1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details