Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2h Peptide - N-terminal region

Ube2h Peptide - N-terminal region

Product Specifications

Product Name Alternative

1500009C23Rik, AI181839, AI326965, AI462483, AW227540, E2-20K, N28148, Ubc8

UniProt

P62257

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2h Rabbit Polyclonal Antibody (orb578685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033485

Preservative

Lyophilized powder

AA Sequence

PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARD1B Blocking Peptide
MBS9621533-01 1 mg

ARD1B Blocking Peptide

Sign In for Pricing
View Details
ARD1B Blocking Peptide
MBS9621533-02 5x 1 mg

ARD1B Blocking Peptide

Sign In for Pricing
View Details
Cavy Immunoglobulin Heavy Constant Delta (IGHD) ELISA Kit
MBS9929072 Inquire

Cavy Immunoglobulin Heavy Constant Delta (IGHD) ELISA Kit

Sign In for Pricing
View Details
Olr1490 sgRNA CRISPR Lentivector set (Rat)
K7419401 3x 1.0 µg

Olr1490 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
SNAI3 Antibody
CSB-PA613772-01 50 μL

SNAI3 Antibody

Sign In for Pricing
View Details
SNAI3 Antibody
CSB-PA613772-02 100 µL

SNAI3 Antibody

Sign In for Pricing
View Details