Atp6v0b Peptide - N-terminal region
Atp6v0b Peptide - N-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Atp6v0b Rabbit Polyclonal Antibody (orb579322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100151
Preservative
Lyophilized powder
AA Sequence
PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C377570-500MG 500 mg
4-(p-Chloro-a-phenylbenzyl)-1-piperazineethanol Dihydrochloride
Sign In for Pricing
View Details 
BNC041082-500 1x 500 µL
MHC II (HLA-DRA) (19-26.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683527-500 1x 500 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 