Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspbp1 Peptide - C-terminal region

Hspbp1 Peptide - C-terminal region

Product Specifications

UniProt

Q6IMX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspbp1 Rabbit Polyclonal Antibody (orb582527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640354

Preservative

Lyophilized powder

AA Sequence

VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stanniocalcin 2 (STC2) (NM_003714) Human Over-expression Lysate
LY401224 100 µg

Stanniocalcin 2 (STC2) (NM_003714) Human Over-expression Lysate

Sign In for Pricing
View Details
TCF7L2 Recombinant Rabbit Monoclonal Antibody [SC06-90]
ET1610-73 100 µL

TCF7L2 Recombinant Rabbit Monoclonal Antibody [SC06-90]

Sign In for Pricing
View Details
MluI, 500U
RE1294 500 U

MluI, 500U

Sign In for Pricing
View Details
3-(4-Chlorophenyl)propan-1-ol
TRC-C596505-5G 5 g

3-(4-Chlorophenyl)propan-1-ol

Sign In for Pricing
View Details
Choline kinase alpha (CHKA) (NM_001277) Human Over-expression Lysate
LC400512 20 µg

Choline kinase alpha (CHKA) (NM_001277) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-2-Chloromandelic Acid
TRC-C432670-500MG 500 mg

(S)-2-Chloromandelic Acid

Sign In for Pricing
View Details