Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB11 Peptide - C-terminal region

PSMB11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BETA5T

UniProt

A5LHX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMB11 Rabbit Polyclonal Antibody (orb586725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001093250

Preservative

Lyophilized powder

AA Sequence

HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r56 3'UTR Lenti-reporter-Luc Vector
49683084 1.0 µg

Vmn1r56 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
VAChT Polyclonal Guinea pig purified antibody
139 105 50 µg

VAChT Polyclonal Guinea pig purified antibody

Sign In for Pricing
View Details
Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit
MBS052460-01 48 Well

Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit
MBS052460-02 96 Well

Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit
MBS052460-03 5x 96 Well

Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit
MBS052460-04 10x 96 Well

Camel Glutamate Cysteine Ligase Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details