Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85A Peptide - N-terminal region

CCDC85A Peptide - N-terminal region

Product Specifications

UniProt

Q96PX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC85A Rabbit Polyclonal Antibody (orb326746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073902

Preservative

Lyophilized powder

AA Sequence

AMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octadecanoyl-L-Carnitine HCl Salt
MBS392478-01 0.1 mg

Octadecanoyl-L-Carnitine HCl Salt

Sign In for Pricing
View Details
Octadecanoyl-L-Carnitine HCl Salt
MBS392478-02 25 mg

Octadecanoyl-L-Carnitine HCl Salt

Sign In for Pricing
View Details
Octadecanoyl-L-Carnitine HCl Salt
MBS392478-03 50 mg

Octadecanoyl-L-Carnitine HCl Salt

Sign In for Pricing
View Details
Octadecanoyl-L-Carnitine HCl Salt
MBS392478-04 100 mg

Octadecanoyl-L-Carnitine HCl Salt

Sign In for Pricing
View Details
Octadecanoyl-L-Carnitine HCl Salt
MBS392478-05 5x 100 mg

Octadecanoyl-L-Carnitine HCl Salt

Sign In for Pricing
View Details
Rabbit Polyclonal SLX1A Antibody
NBP2-54733 100 µL

Rabbit Polyclonal SLX1A Antibody

Sign In for Pricing
View Details