Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO44 Peptide - middle region

FBXO44 Peptide - middle region

Product Specifications

Product Name Alternative

FBG3, FBX30, FBX6A, Fbx44, Fbxo6a

UniProt

Q9H4M3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO44 Rabbit Polyclonal Antibody (orb331378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149438

Preservative

Lyophilized powder

AA Sequence

LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klra12 (NM_010646) Mouse Tagged ORF Clone Lentiviral Particle
MR215005L3V 200 µL

Klra12 (NM_010646) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lgi3 3'UTR Luciferase Stable Cell Line
TU207043 1.0 mL

Lgi3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
3- (2,3-Dihydro-benzo[1,4]dioxin-6-yl) -propionic acid
sc-309584 500 mg

3- (2,3-Dihydro-benzo[1,4]dioxin-6-yl) -propionic acid

Sign In for Pricing
View Details
Gm4745 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22035124 3x 1.0µg DNA

Gm4745 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Anti-Vinculin antibody
SL6640R-01 50 µL

Rabbit Anti-Vinculin antibody

Sign In for Pricing
View Details
Rabbit Anti-Vinculin antibody
SL6640R-02 100 µL

Rabbit Anti-Vinculin antibody

Sign In for Pricing
View Details