Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO44 Peptide - middle region

FBXO44 Peptide - middle region

Product Specifications

Product Name Alternative

FBG3, FBX30, FBX6A, Fbx44, Fbxo6a

UniProt

Q9H4M3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO44 Rabbit Polyclonal Antibody (orb331378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149438

Preservative

Lyophilized powder

AA Sequence

LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cdh22 shRNA (UAS) - Lentiviral mouse Cdh22 shRNA (UAS, iRFP) (25)
GTR15165554 1 Vial

Lentiviral mouse Cdh22 shRNA (UAS) - Lentiviral mouse Cdh22 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RNF34 (NM_194271) Human Tagged ORF Clone Lentiviral Particle
RC211608L1V 200 µL

RNF34 (NM_194271) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dbe Dibasic Ester
OR1024461-01 100 g

Dbe Dibasic Ester

Sign In for Pricing
View Details
Dbe Dibasic Ester
OR1024461-02 500 g

Dbe Dibasic Ester

Sign In for Pricing
View Details
Dbe Dibasic Ester
OR1024461-03 2.5 Kg

Dbe Dibasic Ester

Sign In for Pricing
View Details
Dbe Dibasic Ester
OR1024461-04 10 Kg

Dbe Dibasic Ester

Sign In for Pricing
View Details