Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timm17a Peptide - N-terminal region

Timm17a Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tim17, Timm17

UniProt

O35092

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Timm17a Rabbit Polyclonal Antibody (orb579851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062224

Preservative

Lyophilized powder

AA Sequence

DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), 1mg/mL
BNUM2362-50 1x 50 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), 1mg/mL

Sign In for Pricing
View Details
TOPBP1 Human Gene Knockout Kit (CRISPR)
KN418584 1 Kit

TOPBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXA1 Rabbit Monoclonal Antibody
TA422931 100 µL

FOXA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF488A conjugate, 0.1mg/mL
BNC881812-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renbp Mouse Gene Knockout Kit (CRISPR)
KN514665 1 Kit

Renbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N,N-Diethyl-1-naphthamide
TRC-D444610-500MG 500 mg

N,N-Diethyl-1-naphthamide

Sign In for Pricing
View Details