Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timm17a Peptide - N-terminal region

Timm17a Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tim17, Timm17

UniProt

O35092

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Timm17a Rabbit Polyclonal Antibody (orb579851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062224

Preservative

Lyophilized powder

AA Sequence

DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVK Antibody (Biotin)
KB-1992-01 50 μL

MVK Antibody (Biotin)

Sign In for Pricing
View Details
MVK Antibody (Biotin)
KB-1992-02 100 µL

MVK Antibody (Biotin)

Sign In for Pricing
View Details
MVK Antibody (Biotin)
KB-1992-03 1 mL

MVK Antibody (Biotin)

Sign In for Pricing
View Details
CALM3 (NM_005184) Human Over-expression Lysate
LC401586 20 µg

CALM3 (NM_005184) Human Over-expression Lysate

Sign In for Pricing
View Details
MARVELD1 (NM_031484) Human Over-expression Lysate
LC432633 20 µg

MARVELD1 (NM_031484) Human Over-expression Lysate

Sign In for Pricing
View Details
prothymosin, alpha (PTMA) (75-109) Rabbit Polyclonal Antibody
AP02198SU-S 20 µL

prothymosin, alpha (PTMA) (75-109) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details