Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agtpbp1 Peptide - C-terminal region

Agtpbp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700020N17Rik, 2310001G17Rik, 2900054O13Rik, 4930445M19Rik, 5730402G09Rik, BB114605, CCP1, Nna1, mKIAA1035, nmf243, pcd

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Agtpbp1 Rabbit Polyclonal Antibody (orb582669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075817

Preservative

Lyophilized powder

AA Sequence

GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit
MBS7225883-01 48 Well

Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit
MBS7225883-02 96 Well

Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit
MBS7225883-03 5x 96 Well

Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit
MBS7225883-04 10x 96 Well

Guinea pig ATPase family AAA domain-containing protein 2 (ATAD2) ELISA Kit

Sign In for Pricing
View Details
Synuclein alpha
500-095-L1000 1000 µg

Synuclein alpha

Sign In for Pricing
View Details
Ethyl 2- ([ (4-methoxyphenyl) methyl]amino) acetate
448697-01 100 mg

Ethyl 2- ([ (4-methoxyphenyl) methyl]amino) acetate

Sign In for Pricing
View Details