Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agtpbp1 Peptide - C-terminal region

Agtpbp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700020N17Rik, 2310001G17Rik, 2900054O13Rik, 4930445M19Rik, 5730402G09Rik, BB114605, CCP1, Nna1, mKIAA1035, nmf243, pcd

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Agtpbp1 Rabbit Polyclonal Antibody (orb582669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075817

Preservative

Lyophilized powder

AA Sequence

GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal human Calreticulin Antibody
orb1409792-01 100 µg

Mouse Monoclonal human Calreticulin Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human Calreticulin Antibody
orb1409792-02 50 µg

Mouse Monoclonal human Calreticulin Antibody

Sign In for Pricing
View Details
Human DRAXIN knockout cell line
ABC-KH4429 1 Vial

Human DRAXIN knockout cell line

Sign In for Pricing
View Details
Human Orexin A ELISA Kit
MBS3800297-01 48 Well

Human Orexin A ELISA Kit

Sign In for Pricing
View Details
Human Orexin A ELISA Kit
MBS3800297-02 96 Well

Human Orexin A ELISA Kit

Sign In for Pricing
View Details
Human Orexin A ELISA Kit
MBS3800297-03 5x 96 Well

Human Orexin A ELISA Kit

Sign In for Pricing
View Details