Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTN4RL1 Peptide - C-terminal region

RTN4RL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NGRH2, NgR3

UniProt

Q86UN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTN4RL1 Rabbit Polyclonal Antibody (orb586892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848663

Preservative

Lyophilized powder

AA Sequence

RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate
LC402178 20 µg

NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate

Sign In for Pricing
View Details
SEMA4C Rabbit Polyclonal Antibody
TA381348 100 µL

SEMA4C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant APRIL Antibody
RC-16019-01 50 μL

Recombinant APRIL Antibody

Sign In for Pricing
View Details
Recombinant APRIL Antibody
RC-16019-02 100 µL

Recombinant APRIL Antibody

Sign In for Pricing
View Details
Recombinant APRIL Antibody
RC-16019-03 1 mL

Recombinant APRIL Antibody

Sign In for Pricing
View Details
eIF-6 Mouse Monoclonal Antibody [A6A2]
HA600052 100 µL

eIF-6 Mouse Monoclonal Antibody [A6A2]

Sign In for Pricing
View Details