Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTN4RL1 Peptide - C-terminal region

RTN4RL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NGRH2, NgR3

UniProt

Q86UN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTN4RL1 Rabbit Polyclonal Antibody (orb586892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848663

Preservative

Lyophilized powder

AA Sequence

RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit
RD-8-OHdG-Ge-01 96 Tests

General 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit

Sign In for Pricing
View Details
General 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit
RD-8-OHdG-Ge-02 48 Tests

General 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL
BNC940521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), Biotin conjugate, 0.1mg/mL
BNCB1527-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NYREN18 (NUB1) activation kit by CRISPRa
GA109934 1 Kit

Human NYREN18 (NUB1) activation kit by CRISPRa

Sign In for Pricing
View Details
Zfat Mouse Gene Knockout Kit (CRISPR)
KN519709 1 Kit

Zfat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details