Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSIP2 Peptide - C-terminal region

FSIP2 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSIP2 Rabbit Polyclonal Antibody (orb587013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997365

Preservative

Lyophilized powder

AA Sequence

GNSVKFITIFERSKDVLGSANPSKEVISETPKPDVSKQGSKMLTKMSSTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-APOE Antibody Picoband® Fluoro550 Conjugated
A00015-5-Fluoro550 100 µg/Vial

Anti-APOE Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Cat Tyrosine Kinase, Non Receptor 2 ELISA Kit
MBS096368 Inquire

Cat Tyrosine Kinase, Non Receptor 2 ELISA Kit

Sign In for Pricing
View Details
PDK1 antibody - middle region
MBS3200575-01 0.1 mL

PDK1 antibody - middle region

Sign In for Pricing
View Details
PDK1 antibody - middle region
MBS3200575-02 5x 0.1 mL

PDK1 antibody - middle region

Sign In for Pricing
View Details
Eco AluRack 12 boxes, 50mm, 671x140x140mm, B10
TE11516B10 1 Piece

Eco AluRack 12 boxes, 50mm, 671x140x140mm, B10

Sign In for Pricing
View Details
Human STEAP2 protein
orb419240-01 20 µg

Human STEAP2 protein

Sign In for Pricing
View Details