Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSIP2 Peptide - C-terminal region

FSIP2 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSIP2 Rabbit Polyclonal Antibody (orb587013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997365

Preservative

Lyophilized powder

AA Sequence

GNSVKFITIFERSKDVLGSANPSKEVISETPKPDVSKQGSKMLTKMSSTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc14 (NM_001024354) Rat Tagged Lenti ORF Clone
RR215593L3 10 µg

Lrrc14 (NM_001024354) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ufl1 (NM_026194) Mouse Untagged Clone
MC221639 10 µg

Ufl1 (NM_026194) Mouse Untagged Clone

Sign In for Pricing
View Details
Klf13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6490908 1.0 µg DNA

Klf13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human GMF beta AssayLite FITC-Conjugated Antibody ICC Kit
ICC33158F 1 Kit

Human GMF beta AssayLite FITC-Conjugated Antibody ICC Kit

Sign In for Pricing
View Details
AK5 Polyclonal Antibody
MBS2555684-01 0.06 mL

AK5 Polyclonal Antibody

Sign In for Pricing
View Details
AK5 Polyclonal Antibody
MBS2555684-02 0.12 mL

AK5 Polyclonal Antibody

Sign In for Pricing
View Details