Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT38 Peptide - N-terminal region

KRT38 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HA8, KRTHA8, hHa8

UniProt

O76015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT38 Rabbit Polyclonal Antibody (orb326765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006762

Preservative

Lyophilized powder

AA Sequence

AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MP68 shRNA Plasmid
abx977160-01 150 µg

Mouse MP68 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MP68 shRNA Plasmid
abx977160-02 300 µg

Mouse MP68 shRNA Plasmid

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4745-5p Virus
mh6729 1.0 mL

AdmiRa-Off-hsa-miR-4745-5p Virus

Sign In for Pricing
View Details
EF-1 α1 CRISPR Activation Plasmid (h2)
sc-418458-ACT-2 20 µg

EF-1 α1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Chicken Placenta Growth Factor-1 (PIGF-1) ELISA Kit-Sandwich
EK9F279-01 48 Test

Chicken Placenta Growth Factor-1 (PIGF-1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken Placenta Growth Factor-1 (PIGF-1) ELISA Kit-Sandwich
EK9F279-02 96 Tests

Chicken Placenta Growth Factor-1 (PIGF-1) ELISA Kit-Sandwich

Sign In for Pricing
View Details