Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT38 Peptide - N-terminal region

KRT38 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HA8, KRTHA8, hHa8

UniProt

O76015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT38 Rabbit Polyclonal Antibody (orb326765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006762

Preservative

Lyophilized powder

AA Sequence

AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIGZ Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV696437 1.0 µg DNA

PIGZ Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)
PT_73946-01 2 µg

GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)

Sign In for Pricing
View Details
GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)
PT_73946-02 10 µg

GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)

Sign In for Pricing
View Details
GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)
PT_73946-03 1 mg

GRB2-Related Adaptor Protein 2 Human Recombinant (GRAP2 Human)

Sign In for Pricing
View Details
Recombinant Mouse MPO
Pr22480-01 10 µg

Recombinant Mouse MPO

Sign In for Pricing
View Details
Recombinant Mouse MPO
Pr22480-02 50 µg

Recombinant Mouse MPO

Sign In for Pricing
View Details