Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAR2 Peptide - N-terminal region

AAR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf4, bA234K24.2

UniProt

Q9Y312

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AAR2 Rabbit Polyclonal Antibody (orb326770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056326

Preservative

Lyophilized powder

AA Sequence

KFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPH1 (PTPN3) Human Gene Knockout Kit (CRISPR)
KN415851 1 Kit

PTPH1 (PTPN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Intracellular NADH/NADPH Flow Cytometric Analysis Kit *Red Fluorescence*
15291-AAT 100 Tests

Cell Meter™ Intracellular NADH/NADPH Flow Cytometric Analysis Kit *Red Fluorescence*

Sign In for Pricing
View Details
OR4L1 Antibody
8G608-AAT 50 µg

OR4L1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS713450 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
MAD2L2 Rabbit Polyclonal Antibody
TA378193 100 µL

MAD2L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ttf1 Mouse Gene Knockout Kit (CRISPR)
KN518432 1 Kit

Ttf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details