Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Peptide - N-terminal region

HIKESHI Peptide - N-terminal region

Product Specifications

Product Name Alternative

L7Rn6

UniProt

Q5M808

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIKESHI Rabbit Polyclonal Antibody (orb326134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001013919

Preservative

Lyophilized powder

AA Sequence

GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC98 (A-3)
sc-376951 200 µg/mL

CCDC98 (A-3)

Sign In for Pricing
View Details
Goat anti-Tyrosine Hydroxylase Antibody
MBS421729-01 0.1 mg

Goat anti-Tyrosine Hydroxylase Antibody

Sign In for Pricing
View Details
Goat anti-Tyrosine Hydroxylase Antibody
MBS421729-02 5x 0.1 mg

Goat anti-Tyrosine Hydroxylase Antibody

Sign In for Pricing
View Details
ATP11A siRNA (h)
sc-105104 10 µM

ATP11A siRNA (h)

Sign In for Pricing
View Details
WWTR1 Peptide
MBS3226035-01 0.1 mg

WWTR1 Peptide

Sign In for Pricing
View Details
WWTR1 Peptide
MBS3226035-02 5x 0.1 mg

WWTR1 Peptide

Sign In for Pricing
View Details