Camk1d Peptide - N-terminal region
Camk1d Peptide - N-terminal region
Product Specifications
Product Name Alternative
A630059D12Rik, CKLiK, CaMKIdelta, E030025C11Rik
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Camk1d Rabbit Polyclonal Antibody (orb330923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743528-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3528), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
