Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Camk1d Peptide - N-terminal region

Camk1d Peptide - N-terminal region

Product Specifications

Product Name Alternative

A630059D12Rik, CKLiK, CaMKIdelta, E030025C11Rik

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Camk1d Rabbit Polyclonal Antibody (orb330923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klf15 Mouse Gene Knockout Kit (CRISPR)
KN308828 1 Kit

Klf15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPP2R5C (NM_001161725) Human Over-expression Lysate
LY431474 100 µg

PPP2R5C (NM_001161725) Human Over-expression Lysate

Sign In for Pricing
View Details
Guanidinoethyl Sulfonate-D4
TRC-G483475-1MG 1 mg

Guanidinoethyl Sulfonate-D4

Sign In for Pricing
View Details
Adcy3 Mouse Gene Knockout Kit (CRISPR)
KN500889 1 Kit

Adcy3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ptbp1 Rabbit Polyclonal Antibody
TA363071 100 µL

Ptbp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XRCC1 Rabbit Monoclonal Antibody [Clone ID: R02-0B0]
TA421660 100 µL

XRCC1 Rabbit Monoclonal Antibody [Clone ID: R02-0B0]

Sign In for Pricing
View Details