Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LINGO2 Peptide - N-terminal region

LINGO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LERN3, LRRN6C

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LINGO2 Rabbit Polyclonal Antibody (orb586621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q7L985

Preservative

Lyophilized powder

AA Sequence

ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASC2 (PYDC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C10]
TA803466BM 100 µL

ASC2 (PYDC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C10]

Sign In for Pricing
View Details
Muscimol Biotin
TRC-M856450-25MG 25 mg

Muscimol Biotin

Sign In for Pricing
View Details
(2-Cyclobuten-1-ylseleno)-benzene
TRC-C990238-5MG 5 mg

(2-Cyclobuten-1-ylseleno)-benzene

Sign In for Pricing
View Details
PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI20G10]
CF810750 100 µg

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI20G10]

Sign In for Pricing
View Details
Tilmicosin Phosphate Salt (~80%)
TRC-T440503-25MG 25 mg

Tilmicosin Phosphate Salt (~80%)

Sign In for Pricing
View Details
Recombinant Human PPM1A protein (His tag)
PDEH101083-01 20 µg

Recombinant Human PPM1A protein (His tag)

Sign In for Pricing
View Details