LINGO2 Peptide - N-terminal region
LINGO2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
LERN3, LRRN6C
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LINGO2 Rabbit Polyclonal Antibody (orb586621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
Q7L985
Preservative
Lyophilized powder
AA Sequence
ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![2-Hydroxydibenz[b,e]oxepin-11(6H)-one](https://cdn.genprice.uk/products/572/2594658969535/imageurl/trc-h939555-5mg.webp)
PKSH030411 50 µg
Recombinant Human PKC iota/PRKCI Protein (GST Tag)
Sign In for Pricing
View Details ![FITC Anti-Mouse CD162 Antibody[4RA10]](https://cdn.genprice.uk/products/763/68dd1496061270361e7cdc26/imageurl/e-ab-f1034uc.webp)
MCW04F-COOH 10x 96 Well Plates
Carboxylated - 96 well Solid plates - White PS
Sign In for Pricing
View Details