C12orf65 Peptide - C-terminal region
C12orf65 Peptide - C-terminal region
Product Specifications
Product Name Alternative
COXPD7
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C12orf65 Rabbit Polyclonal Antibody (orb326729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
Q9H3J6
Preservative
Lyophilized powder
AA Sequence
HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
10840071-AAT 500 Tests
IFluor® 532 Anti-human CD84 Antibody *CD84.1.21*
Sign In for Pricing
View Details BAL1197 1 Each
Anti-FLAG Tag Rabbit Monoclonal Antibody, 1 pack = 500 µL
Sign In for Pricing
View Details