Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf65 Peptide - C-terminal region

C12orf65 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COXPD7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C12orf65 Rabbit Polyclonal Antibody (orb326729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q9H3J6

Preservative

Lyophilized powder

AA Sequence

HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc9 ORF Vector (Mouse) (pORF)
50413014 1.0 µg DNA

Wfdc9 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CTTNBP2 Rabbit Polyclonal Antibody (BF647)
orb2517913 100 µL

CTTNBP2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SNX-2112 100mg
A11189-100 100 mg

SNX-2112 100mg

Sign In for Pricing
View Details
Mouse Monoclonal TFPI-2 Antibody (MM0564-9F6)
NBP2-11918 0.1 mg

Mouse Monoclonal TFPI-2 Antibody (MM0564-9F6)

Sign In for Pricing
View Details
GAP-43 (B-5) FITC
sc-17790 FITC 200 µg/mL

GAP-43 (B-5) FITC

Sign In for Pricing
View Details
Lentiviral human CAV1 sgRNA gene knockout kit - Lentiviral human CAV1 sgRNA gene knockout kit (plasmid)
GTR15358397 1 Vial

Lentiviral human CAV1 sgRNA gene knockout kit - Lentiviral human CAV1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details